PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00054017001
Common NameGSBRNA2T00054017001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 309aa    MW: 33961.1 Da    PI: 10.2688
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00054017001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1002.3e-31186241258
            CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          ep +VNaKQyq+Il+RRq+Rakle+++kl +k+rkpylheSRh hAl+R+RgsgGrF
  GSBRNA2T00054017001 186 EPSFVNAKQYQAILRRRQHRAKLEAQNKL-IKARKPYLHESRHLHALKRARGSGGRF 241
                          8****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-35183244IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.959184244IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.3E-26186241IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.0E-22187209IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860189209IPR018362CCAAT-binding factor, conserved site
PRINTSPR006168.0E-22218241IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MQEFHRKDSL SSPTTSWGNS VFSNSNVQGS SSSAMTDNNN NNNNTLSLTM EMMSAHFPGM  60
KQTGFQLQGH DDSSSTLSTG GGESSGDVAS LGGHNSNNRY GHNFVTHKEL TCVCNVFPSG  120
SHPKSILSKV SQNSAAPTIE ASWPLHGNCF MSFPYASQHM VQQHPQIGGL MIPSRILLPP  180
YIPENEPSFV NAKQYQAILR RRQHRAKLEA QNKLIKARKP YLHESRHLHA LKRARGSGGR  240
FLNTKKLQES KSPPFLATSV KFRQREILGV AVGSSGPELT GNNMDMFQQD PQLRFSGYPS  300
NHHVSVLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-18186246363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00054017001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013673284.10.0PREDICTED: nuclear transcription factor Y subunit A-6 isoform X4
SwissprotQ9LVJ71e-114NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLA0A078H8S40.0A0A078H8S4_BRANA; BnaC01g37260D protein
STRINGBra021527.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-95nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]